Hamartin/TSC1 Polyclonal antibody

• 

  WB analysis of mouse kidney using 29906-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 29906-1-AP (Hamartin/TSC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29906-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29906-1-AP (TSC1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 29906-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 29906-1-AP (Hamartin/TSC1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 29906-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 29906-1-AP (Hamartin/TSC1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 29906-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 29906-1-AP (Hamartin/TSC1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 29906-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 29906-1-AP (Hamartin/TSC1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of hTERT-RPE1 using 29906-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using Hamartin/TSC1 antibody (29906-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Hamartin/TSC1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29906-1-AP

Publications(5)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TSC1, TSC 1, TSC, LAM, KIAA0243

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse kidney tissue, MCF-7 cells
• Positive IHC detected in: mouse kidney tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

29906-1-AP targets Hamartin/TSC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31621

  Product name: Recombinant human TSC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 965-1164 aa of NM_000368

  Sequence: LYGRLEKDGLLKKLEEEKAEAAEAAEERLDCCNDGCSDSMVGHNEEASGHNGETKTPRPSSARGSSGSRGGGGSSSSSSELSTPEKPPHQRAGPFSSRWETTMGEASASIPTTVGSLPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELGKDLGVEAKIPLNLDGPHPSPPTPDSVGQLHIMDYNETHHEHS

• Full Name: tuberous sclerosis 1
• Calculated Molecular Weight: 130KD
• Observed Molecular Weight: 140-145 kDa
• GenBank Accession Number: NM_000368
• Gene Symbol: Hamartin/TSC1
• Gene ID (NCBI): 7248
• RRID: AB_2918352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92574
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TSC1, also named as hamartin, interacts with TSC2 to form a protein complex that inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling (PubMed: 12271141, PubMed: 28215400). It can recruit TSC2 to HSP90AA1 and stabilizes TSC2 by preventing the interaction between TSC2 and ubiquitin ligase HERC1 (PubMed: 16464865, PubMed: 29127155). The loss of TSC1/TSC2 in mouse neurons resulted in a block in oligodendrocyte hypomyelination in vivo (PubMed: 28183733).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Genes Dis; Naked cuticle homolog 2 controls the differentiation of osteoblasts and osteoclasts and ameliorates bone loss in ovariectomized mice; Authors - Liying Shan
human	WB	Mol Cell; YTHDF1 differentiates the contributing roles of mTORC1 in aging; Authors - Chenzhong Xu
human	WB	Elife; A cleaved METTL3 potentiates the METTL3-WTAP interaction and breast cancer progression; Authors - Chaojun Yan
human	WB	Cell Signal; METTL14-mediated N6-methyladenosine modification of TCP1 mRNA promotes acute myeloid leukemia progression; Authors - Mengmeng Zhang
human	WB,IP,IHC,IF	Br J Cancer; CDK4/6 inhibitors dephosphorylate RNF26 to stabilize TSC1 and increase the sensitivity of ccRCC to mTOR inhibitors; Authors - Xinlin Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Shivali (Verified Customer) (09-13-2025)

We are working on how negative regulators of mTOR complex affect translation and used this antibody to check TSC1 knockout cell lines. Worked well

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000

FH

Parijat (Verified Customer) (08-27-2025)

I used this antibody to confirm TSC2 knockout in both human (eHap1) and mouse (IMCD3) cells and it worked great. Although in Mouse there were few non-specific bands, it was much cleaner in Human cells.

• Applications: Western Blot
• Primary Antibody Dilution: 1:3000