THEMIS Polyclonal antibody

• 

  WB analysis of Jurkat using 27415-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 27415-1-AP (TSEPA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 27415-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27415-1-AP (TSEPA antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 27415-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27415-1-AP (TSEPA antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 27415-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27415-1-AP (TSEPA antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 27415-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 27415-1-AP (TSEPA antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

THEMIS Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27415-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

TSEPA, Thymocyte-expressed molecule involved in selection, Protein THEMIS, C6orf207, C6orf190

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human tonsillitis tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

27415-1-AP targets THEMIS in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26387

  Product name: Recombinant human TSEPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 61-222 aa of BC130516

  Sequence: AEICEQIEGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSFNLPLSQEGEFYECEDERIYTLKEIVEWKIPKNRTRTVNLTDFSNKWDSTNPFPKDFYGT

• Full Name: thymocyte selection pathway associated
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC130516
• Gene Symbol: THEMIS
• Gene ID (NCBI): 387357
• RRID: AB_2880866
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N1K5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The T cell lineage-restricted protein THEMIS, also called C6orf190 and C6orf207, plays a critical role in T cell development at the positive selection stage (PMID: 37159521). THEMIS plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. It is required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells and regulates T-cell development through T-cell antigen receptor (TCR) signaling (PMID: 28697966, 28250424). It can also promote the proliferative response of CD8+ T cells to low-affinity ligands (PMID: 31932808).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	IF	Theranostics; Single cell analyses reveal the PD-1 blockade response-related immune features in hepatocellular carcinoma; Authors - Yao Li