TSGA13 Polyclonal antibody

• 

  IHC staining of human testis using 17326-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17326-1-AP (TSGA13 Antibody) at dilution of 1:50 (under 10x lens).

TSGA13 Polyclonal Antibody for IHC, ELISA

Cat No. 17326-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

testis specific, 13, TSGA13

---

Tested Applications

• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17326-1-AP targets TSGA13 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11305

  Product name: Recombinant human TSGA13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-275 aa of BC038415

  Sequence: MSQKRQTKFQNGKSKTSENSSAKREKGMVVNSKEISDAVGQSKFVLENLRHYTVHPNLAQYYKPLKATALQKFLAQNRKNTSFMLKVTQYDQDKTLLIMTNNPPPCSITQQDKESASKYFSKELLLKVMESHHQHKPTENLWLPRMPQKKKLRSKLKPIFPLILSDDPTSKREQWFRFSTDNDFKSEGKYSKVYALRTQKKMYPQLTFAPVHERDMRKDASKKSASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVIG

• Full Name: testis specific, 13
• Calculated Molecular Weight: 275 aa, 32 kDa
• GenBank Accession Number: BC038415
• Gene Symbol: TSGA13
• Gene ID (NCBI): 114960
• RRID: AB_2878382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PP4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.