TSH Beta Polyclonal antibody

• 

  IHC staining of human pituitary using 27288-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 27288-1-AP (TSH beta antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary using 27288-1-AP

  Immunohistochemical analysis of paraffin-embedded human pituitary tissue slide using 27288-1-AP (TSH beta antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TSH Beta Polyclonal Antibody for IHC, ELISA

Cat No. 27288-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

CHNG4, Thyrotropin alfa, Thyrotropin beta chain, Thyrotropin subunit beta, TSH B, TSH BETA, TSHB

---

Tested Applications

• Positive IHC detected in: human pituitary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27288-1-AP targets TSH Beta in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25532

  Product name: Recombinant human TSHB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 65-138 aa of BC069298

  Sequence: YALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV

• Full Name: thyroid stimulating hormone, beta
• Calculated Molecular Weight: 138 aa, 16 kDa
• GenBank Accession Number: BC069298
• Gene Symbol: TSH beta
• Gene ID (NCBI): 7252
• RRID: AB_2880831
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01222
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.