TSKS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TSKS Polyclonal antibody (33992-1-AP)

• 

  WB analysis using 33992-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33992-1-AP (TSKS antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

TSKS Polyclonal Antibody for WB, ELISA

Cat No. 33992-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

STK22 substrate 1, STK22S1, Testis-specific kinase substrate, Testis-specific serine kinase substrate, TSKS1

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33992-1-AP targets TSKS in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38588

  Product name: Recombinant human TSKS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 328-592 aa of NM_021733.1

  Sequence: EELRREVSSLTARWHQEEGAVQEALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCARCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ

• Full Name: testis-specific serine kinase substrate
• Calculated Molecular Weight: 65kDa，592aa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: NM_021733.1
• Gene Symbol: TSKS
• Gene ID (NCBI): 60385
• RRID: AB_3743135
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UJT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Testis-specific serine kinase substrate (TSKS) was identified as a substrate for testis-specific serine kinase 1 (TSSK1) and TSSK2. Although these three proteins co-localize to nuage, double knockout (KO) mice lacking TSSK1 and TSSK2 (Tssk1/2 dKO mice) exhibit abnormal mitochondrial sheath formation, suggesting that these proteins and nuage are involved in mitochondrial sheath formation. However, the previous study observed abundant cytoplasm in the late spermatids at seminiferous tubule stage VIII of the Tssk1/2 dKO mouse. Furthermore, an interaction between TSKS and phosphatase protein PPP1CC2 was also reported previously. Protein phosphatase 1 catalytic subunit gamma (Ppp1cc) is a member of the PP1 family of protein phosphatases that encodes two splice isoforms: the ubiquitous Ppp1cc1 and the testis-specific Ppp1cc2. Ppp1cc knockout (KO) male mice also exhibit malformed mitochondrial sheath formation. These data indicate that the kinase and phosphatase of TSKS are involved in the formation of the mitochondrial sheath (PMID: 36881620).