TSNAX Polyclonal antibody

• 

  WB analysis using 11040-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11040-1-AP (TSNAX antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11040-1-AP

  IP result of anti-TSNAX (IP:11040-1-AP, 4ug; Detection:11040-1-AP 1:300) with HeLa cells lysate 2400ug.

• 

  IHC staining of human gliomas using 11040-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11040-1-AP (TSNAX antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of MCF-7 using 11040-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using TSNAX antibody (11040-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

TSNAX Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11040-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

translin associated factor X, Translin associated protein X, Translin-associated factor X, Translin-associated protein X, TRAX

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11040-1-AP targets TSNAX in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1507

  Product name: Recombinant human TSNAX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-290 aa of BC011797

  Sequence: MSNKEGSGGFRKRKHDNFPHNQRREGKDVNSSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEDILTESEIKLDGVRQKIFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS

• Full Name: translin-associated factor X
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC011797
• Gene Symbol: TSNAX
• Gene ID (NCBI): 7257
• RRID: AB_2303821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99598
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.