• Featured Product
  • KD/KO Validated

TSPAN1 Polyclonal antibody

TSPAN1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 16058-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Tetraspan NET-1, Tetraspanin TM4-C, Tetraspanin-1, Tspan-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, COLO 320 cells, rat colon tissue
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16058-1-AP targets TSPAN1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8786

Product name: Recombinant human TSPAN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-215 aa of BC013404

Sequence: MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV

Predict reactive species
Full Name tetraspanin 1
Calculated Molecular Weight 241 aa, 26 kDa
Observed Molecular Weight 26-30 kDa
GenBank Accession NumberBC013404
Gene Symbol TSPAN1
Gene ID (NCBI) 10103
RRIDAB_2878210
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60635
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TSPAN1 is a membrane protein of the tetraspanin superfamily, which is characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. Altered TSPAN1 expression has been associated with the progression of some neoplasms including hepatocellular carcinoma, colorectal, gastric, and breast cancers (PMID: 20890423; 19437569; 18822690; 20680643).

Protocols

Product Specific Protocols
IHC protocol for TSPAN1 antibody 16058-1-APDownload protocol
WB protocol for TSPAN1 antibody 16058-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Autophagy

TSPAN1 promotes autophagy flux and mediates cooperation between WNT-CTNNB1 signaling and autophagy via the MIR454-FAM83A-TSPAN1 axis in pancreatic cancer.

Authors - Cefan Zhou
  • KD Validated
ratWB,IP,IF

Cell Mol Life Sci

Tetraspanin1 promotes NGF signaling by controlling TrkA receptor proteostasis.

Authors - Facundo Ferrero Restelli
  • KD Validated
mouse,humanWB,IF,CoIP

Neurochem Res

4,5-Dimethoxycanthin-6-one Inhibits Glioblastoma Stem Cell and Tumor Growth by Inhibiting TSPAN1 Interaction with TM4SF1

Authors - Wei Li
humanWB,IF

Gene

Targeting TSPAN1 promotes ferroptosis in endometrial cancer cells, reduces energy metabolism and inhibits malignant behavior

Authors - Yang Fan
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...