TSPAN14 Polyclonal antibody, PBS Only

• 

  WB analysis of A549 using 15314-1-AP (same clone as 15314-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 15314-1-AP (TSPAN14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15314-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 15314-1-AP (same clone as 15314-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 15314-1-AP (TSPAN14 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15314-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 15314-1-AP (same clone as 15314-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 15314-1-AP (TSPAN14 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15314-1-PBS in a different storage buffer formulation.

TSPAN14 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15314-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

15314-1-PBS targets TSPAN14 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7551

  Product name: Recombinant human TSPAN14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-219 aa of BC002920

  Sequence: LFQDWVRDRFREFFESNIKSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKCGVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDESIFTKGCIQALESWLPRNIYIV

• Full Name: tetraspanin 14
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC002920
• Gene Symbol: TSPAN14
• Gene ID (NCBI): 81619
• RRID: AB_2918039
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NG11
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TSPAN14 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN14 belongs to the TSPANC8 subfamily, which also include TSPAN5, TSPAN10, TSPAN15, TSPAN17, and TSPAN33. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126).