Product Information
15919-1-PBS targets TSPAN18 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8724 Product name: Recombinant human TSPAN18 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-267 aa of BC019342 Sequence: NGPEDFKFASVFRLLTLDSEEVPEACCRREPQSRDGVLLSREECLLGRSLFLNKQGCYTVILNTFETYVYLAGALAIGVLAIEEERAHSVSQATGILYQLPASPQAFQSPGTLGATA Predict reactive species |
| Full Name | tetraspanin 18 |
| Calculated Molecular Weight | 267 aa, 29 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC019342 |
| Gene Symbol | TSPAN18 |
| Gene ID (NCBI) | 90139 |
| RRID | AB_3669225 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96SJ8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TSPAN18 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN18 gene mutation has been associated with Schizophrenia in Han Chinese (PMID: 22037552; 23505562).

