Tested Applications
| Positive WB detected in | HL-60 cells, K-562 cells |
| Positive IP detected in | HL-60 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:300-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20463-1-AP targets TSPAN2 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14299 Product name: Recombinant human TSPAN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 101-199 aa of BC021675 Sequence: AEVTTGVFAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQLIGIVGIGIAGL Predict reactive species |
| Full Name | tetraspanin 2 |
| Calculated Molecular Weight | 221 aa, 24 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC021675 |
| Gene Symbol | TSPAN2 |
| Gene ID (NCBI) | 10100 |
| RRID | AB_2878691 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60636 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TSPAN2 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. It has been reported that TSPAN2 is involved in cell invasion and motility during lung cancer progression (PMID: 24726368). TSPAN2 enhances cell motility and invasiveness by assisting CD44 in scavenging intracellular reactive oxygen species.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for TSPAN2 antibody 20463-1-AP | Download protocol |
| WB protocol for TSPAN2 antibody 20463-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TSPAN2 Polyclonal antibody (Cat# 20463-1-AP) has 4 total citations. These appear in Glia, Journal of Molecular Medicine, FASEB Journal, and eLife. The research fields span CNS myelin proteomics and oligodendrocyte biology, endometriosis progression via tetraspanin-2 transcriptional regulation, and TSPAN2 expression in vascular smooth muscle. Applications cited include Western blotting and immunofluorescence, with studies conducted in human and mouse models.
| Species | Application | Title |
|---|---|---|
Glia Developmental maturation and regional heterogeneity but no sexual dimorphism of the murine CNS myelin proteome | ||
J Mol Med (Berl) Nuclear factor IX promotes endometriosis progression through transcriptional activation of tetraspanin-2.
| ||
FASEB J Selective expression of TSPAN2 in vascular smooth muscle is independently regulated by TGF-β1/SMAD and myocardin/serum response factor. | ||
Elife Conservation and divergence of myelin proteome and oligodendrocyte transcriptome profiles between humans and mice. |
