TSPAN32 Polyclonal antibody

• 

  WB analysis of mouse spleen using 20320-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 20320-1-AP (TSPAN32 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

TSPAN32 Polyclonal Antibody for WB, ELISA

Cat No. 20320-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

PHEMX, PHMX, Protein Phemx, tetraspanin 32, Tspan 32, TSPAN32, TSSC6

---

Tested Applications

• Positive WB detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20320-1-AP targets TSPAN32 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14174

  Product name: Recombinant human TSPAN32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-202 aa of BC016693

  Sequence: LAFCAQVQVVFWRLHSPTQVEDAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAREDCLQGIRSFLRTHQQVASSLT

• Full Name: tetraspanin 32
• Calculated Molecular Weight: 320 aa, 35 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC016693
• Gene Symbol: TSPAN32
• Gene ID (NCBI): 10077
• RRID: AB_2878672
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QS1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.