TSPAN8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSPAN8 Polyclonal antibody, PBS Only (20319-1-PBS)

• 

  WB analysis using 20319-1-AP (same clone as 20319-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20319-1-AP (TSPAN8 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20319-1-PBS in a different storage buffer formulation.

• 

  IP experiment of PC-12 using 20319-1-AP (same clone as 20319-1-PBS)

  IP result of anti-TSPAN8 (IP:20319-1-AP, 4ug; Detection:20319-1-AP 1:1000) with PC-12 cells lysate 1560 ug. This data was developed using the same antibody clone with 20319-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 20319-1-AP (same clone as 20319-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 20319-1-AP (TSPAN8 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20319-1-PBS in a different storage buffer formulation.

TSPAN8 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 20319-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CO 029, tetraspanin 8, Tetraspanin-8, TM4SF3, Tspan 8

---

Product Information

20319-1-PBS targets TSPAN8 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14173

  Product name: Recombinant human TSPAN8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-217 aa of BC005246

  Sequence: LLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGIAFGLA

• Full Name: tetraspanin 8
• Calculated Molecular Weight: 237 aa, 26 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC005246
• Gene Symbol: TSPAN8
• Gene ID (NCBI): 7103
• RRID: AB_3741986
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P19075
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TSPAN8 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN8 and CD151 coordinately promote metastasis, where Tspan8 overrides the adhesive features of CD151 by recruiting integrins out of adhesion into motility promoting complexes (PMID: 23683890). TSPAN8 contributes to molecular pathways of exosome-induced endothelial cell activation (PMID: 20124479).