TSPYL2/CDA1 Recombinant monoclonal antibody, PBS Only

TSPYL2/CDA1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 87406-1-PBS
Clone No.252804E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

CDA1, TSPX, TSPYL2, Cell division autoantigen 1, CINAP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87406-1-PBS targets TSPYL2/CDA1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag41206

Product name: Recombinant human TSPYL2,TSPX,NP79 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 344-693 aa of BC024270

Sequence: WHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYGNNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDDRDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSEDVWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG

Predict reactive species
Full Name TSPY-like 2
Calculated Molecular Weight 693 aa, 79 kDa
Observed Molecular Weight 120 kDa
GenBank Accession NumberBC024270
Gene Symbol CDA1
Gene ID (NCBI) 64061
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H2G4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TSPYL2 (also known as CINAP, CDA1, TSPX or DENTT) is a new member of the nucleosome assembly protein superfamily. TSPYL2 binds histones and facilitates nucleosome assembly. TSPYL2 is expressed in various tissues, highly in the pituitary gland and moderately in the adrenals, brain, testis, and ovary. Immunohistochemical staining analysis for TSPYL2 showed differential cytoplasmic and nuclear staining patterns in several cell types. Downregulated expression of TSPYL2 has been observed in several tumors, which suggests its role as a tumor suppressor. Although it is predicted that TSPYL2 has a molecular mass of 79.43 kDa, it is found that mammalian TSPYL2 appears at a size of 120 kDa by western blot analysis. The abundant acidic amino acid regions in TSPYL2 may cause its aberrant migration. In addition, the TSPYL2 protein is unstable and sensitive to proteasomal degradation.

Loading...
||
New chat

Able

正在加载,请稍候...