TSPYL4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TSPYL4 Polyclonal antibody, PBS Only (17576-1-PBS)

• 

  WB analysis using 17576-1-AP (same clone as 17576-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17576-1-AP (TSPYL4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17576-1-PBS in a different storage buffer formulation.

TSPYL4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17576-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17576-1-PBS targets TSPYL4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10730

  Product name: Recombinant human TSPYL4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 5-235 aa of BC009116

  Sequence: KVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMLRYMINLEVEELKHPRAGCKFKFIFQGNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQDPQAHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKGELWPNPLQYYLMGEGPRRGIRGPPRQPVESARSFRFQSG

• Full Name: TSPY-like 4
• Calculated Molecular Weight: 414 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC009116
• Gene Symbol: TSPYL4
• Gene ID (NCBI): 23270
• RRID: AB_2272537
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJ04
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.