TSR1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TSR1 Polyclonal antibody (16887-1-AP)

TSR1 Polyclonal Antibody for WB, ELISA

Cat No. 16887-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, ELISA

Synonyms

KIAA1401, TSR1

• 

  WB analysis of L02 using 16887-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 16887-1-AP (TSR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TSR1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16887-1-AP targets TSR1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10394

  Product name: Recombinant human TSR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 411-759 aa of BC019090

  Sequence: DDLYDKKVDEEAEAKMLEKYKQERLEEMFPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTLHVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKEELIFHCGFRRFRASPLFSQHTAADKHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVVLSGHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLYKRVFPKWTYDPYVPEPVPWLKSEISSTVPQGGME

• Full Name: TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)
• Calculated Molecular Weight: 804 aa, 92 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC019090
• Gene Symbol: TSR1
• Gene ID (NCBI): 55720
• RRID: AB_2222589
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2NL82
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TSR1 polyclonal antibody (Cat# 16887-1-AP) has 3 total citations. These appear in Cell Chemical & Biology, iScience, and Microbial Pathogenesis. The associated research fields span cancer proteomics and precision prognosis, posttranscriptional gene regulation in human pluripotent stem cells, and comparative proteomics of swine kidney cells infected with pseudorabies virus variants. All three citations used the antibody for Western blot applications.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Chem Biol; Novel RNA-Affinity Proteogenomics Dissects Tumor Heterogeneity for Revealing Personalized Markers in Precision Prognosis of Cancer.; Authors - Li Wang
human	WB	iScience; Multi-omics approach reveals posttranscriptionally regulated genes are essential for human pluripotent stem cells.; Authors - Mio Iwasaki
pig	WB	Microb Pathog; Comparative proteomic analysis of PK15 swine kidney cells infected with a pseudorabies pathogenic variant and the Bartha-K/61 vaccine strain; Authors - Hongliang Zhang