TSTA3 Polyclonal antibody

• 

  WB analysis of human colon using 15335-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 15335-1-AP (TSTA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 15335-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15335-1-AP (TSTA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 15335-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15335-1-AP (TSTA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15335-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15335-1-AP (TSTA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 15335-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15335-1-AP (TSTA3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 15335-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15335-1-AP (TSTA3 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 15335-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15335-1-AP (TSTA3 Antibody) at dilution of 1:200 (under 40x lens).

TSTA3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15335-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

FX, GDP L fucose synthase, P35B, Protein FX, SDR4E1, TSTA3

---

Tested Applications

• Positive WB detected in: human colon tissue, HEK-293 cells, HeLa cells, human brain tissue, human kidney tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15335-1-AP targets TSTA3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7450

  Product name: Recombinant human TSTA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-321 aa of BC001941

  Sequence: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARK

• Full Name: tissue specific transplantation antigen P35B
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 40 kDa, 68 kDa
• GenBank Accession Number: BC001941
• Gene Symbol: TSTA3
• Gene ID (NCBI): 7264
• RRID: AB_2211226
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13630
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.