TTC26 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TTC26 Polyclonal antibody (25083-1-AP)

TTC26 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 25083-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

dyf 13, IFT56

• 

  WB analysis of mouse testis using 25083-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25083-1-AP (TTC26 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25083-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25083-1-AP (TTC26 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 25083-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25083-1-AP (TTC26 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 25083-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 25083-1-AP (TTC26 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 25083-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25083-1-AP (TTC26 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of hTERT-RPE1 using 25083-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using TTC26 antibody (25083-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CoraLite®594 ARL13B antibody (CL594-17711, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TTC26 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HEK-293 cells, NIH/3T3 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25083-1-AP targets TTC26 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18983

  Product name: Recombinant human TTC26 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 194-544 aa of BC126331

  Sequence: CYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMK

• Full Name: tetratricopeptide repeat domain 26
• Calculated Molecular Weight: 554 aa, 64 kDa
• Observed Molecular Weight: 60-64 kDa
• GenBank Accession Number: BC126331
• Gene Symbol: TTC26
• Gene ID (NCBI): 79989
• RRID: AB_2651173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0AVF1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TTC26 (Tetratricopeptide repeat protein 26), also known as IFT56 (Intraflagellar transport protein 56), is an IFT complex B protein, which has a role in transport of ciliary cargo, important for ciliary motility and construction of full length cilia (PMID: 38135897). Severe biliary ciliopathy, caused by bi-allelic mutations in TTC26, has been recently described in the context of a syndrome of polydactyly and severe neonatal cholestasis, with brain, kidney and heart involvement (PMID: 32617964).

Publications

What published studies show

The TTC26 Polyclonal antibody (Cat# 25083-1-AP) has 1 total citation. It was cited in Developmental Cell in a 2017 study by Kanie et al. examining the CEP19-RABL2 GTPase complex's role in initiating intraflagellar transport at the ciliary base. The research field is cilia biology and intraflagellar transport. The antibody was used for Western blot on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Dev Cell; The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base.; Authors - Tomoharu Kanie