TTC26 Polyclonal antibody

TTC26 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 25083-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

IFT56, dyf 13

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, HEK-293 cells, NIH/3T3 cells
Positive IF/ICC detected inhTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

25083-1-AP targets TTC26 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18983

Product name: Recombinant human TTC26 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 194-544 aa of BC126331

Sequence: CYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDDVQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYSAKAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGREPKETLREVLHLLRSTGNTQVEYMIRIMK

Predict reactive species
Full Name tetratricopeptide repeat domain 26
Calculated Molecular Weight 554 aa, 64 kDa
Observed Molecular Weight 60-64 kDa
GenBank Accession NumberBC126331
Gene Symbol TTC26
Gene ID (NCBI) 79989
RRIDAB_2651173
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDA0AVF1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TTC26 (Tetratricopeptide repeat protein 26), also known as IFT56 (Intraflagellar transport protein 56), is an IFT complex B protein, which has a role in transport of ciliary cargo, important for ciliary motility and construction of full length cilia (PMID: 38135897). Severe biliary ciliopathy, caused by bi-allelic mutations in TTC26, has been recently described in the context of a syndrome of polydactyly and severe neonatal cholestasis, with brain, kidney and heart involvement (PMID: 32617964).

Protocols

Product Specific Protocols
IF protocol for TTC26 antibody 25083-1-APDownload protocol
WB protocol for TTC26 antibody 25083-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Dev Cell

The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base.

Authors - Tomoharu Kanie
Loading...
||
New chat Able
正在加载,请稍候...