TTC31 Polyclonal antibody, PBS Only

• 

  WB analysis of PC-3 using 21693-1-AP (same clone as 21693-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21693-1-AP (TTC31 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21693-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 21693-1-AP (same clone as 21693-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21693-1-AP (TTC31 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21693-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 21693-1-AP (same clone as 21693-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21693-1-AP (TTC31 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 21693-1-AP (same clone as 21693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 21693-1-AP (TTC31 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 21693-1-AP (same clone as 21693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 21693-1-AP (TTC31 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21693-1-AP (same clone as 21693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 21693-1-AP (TTC31 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21693-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21693-1-AP (same clone as 21693-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 21693-1-AP (TTC31 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21693-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 21693-1-AP (same clone as 21693-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 21693-1-AP (TTC31 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21693-1-PBS in a different storage buffer formulation.

TTC31 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21693-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21693-1-PBS targets TTC31 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16281

  Product name: Recombinant human TTC31 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-358 aa of BC098365

  Sequence: MAPIPKTVGRIKLDCSLRPSCPLEVAAAPKLCKEFGPEDYGEEDIVDFLRRLVESDPQGLHRIHVDGSSGRLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSASATFPSVSDSLLQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLKKKRQKERKRQERLEQYCGEPKASTTSDGDESPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEEESPPREERPQQSPKEKDLGRLRPQDLLDFAPYPQASPGLLAAALQQSQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHR

• Full Name: tetratricopeptide repeat domain 31
• Calculated Molecular Weight: 358 aa, 40 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC098365
• Gene Symbol: TTC31
• Gene ID (NCBI): 64427
• RRID: AB_11182824
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q49AM3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.