TTC35 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TTC35 Polyclonal antibody (25443-1-AP)

• Featured Product
• KD/KO Validated

TTC35 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 25443-1-AP Copied!

Publications (19)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EMC2, ER membrane protein complex subunit 2, KIAA0103, TPR repeat protein 35

• 

  WB analysis using 25443-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 25443-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SKOV-3 using 25443-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 25443-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 25443-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 25443-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 25443-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 25443-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 25443-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 25443-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 25443-1-AP (TTC35 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse heart using 25443-1-AP

  IP result of anti-TTC35 (IP:25443-1-AP, 3ug; Detection:25443-1-AP 1:600) with mouse heart tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 25443-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 25443-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 25443-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 25443-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 25443-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 25443-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 25443-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 25443-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 25443-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 25443-1-AP (TTC35 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TTC35 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, human placenta tissue, K-562 cells, MCF-7 cells, mouse heart tissue, mouse spleen tissue, NIH/3T3 cells, PC-3 cells, SKOV-3 cells
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: human ovary cancer tissue, rat stomach tissue, rat brain tissue, mouse lung tissue, human placenta tissue, human lung cancer tissue, mouse brain tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25443-1-AP targets TTC35 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22196

  Product name: Recombinant human TTC35 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-297 aa of BC021667

  Sequence: MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS

• Full Name: tetratricopeptide repeat domain 35
• Calculated Molecular Weight: 297 aa, 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC021667
• Gene Symbol: TTC35
• Gene ID (NCBI): 9694
• RRID: AB_2750836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15006
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TPR repeat protein 35 (TTC35), also named as tetratricopeptide repeat domain 35, is a 297 amino acid protein, which contains three TPR repeats and belongs to the EMC2 family. TTC35 localizes in the nucleus and cytoplasm. TTC35 is a component of the ER membrane protein complex and may be a putative O-linked glycosyl transferase.

Publications

What published studies show

The TTC35 Polyclonal antibody (Cat# 25443-1-AP) has 19 citations published in journals including Nature, Cell, Nature Communications, Molecular Cell, EMBO Molecular Medicine, Journal of Cell Biology, PLoS Pathogens, iScience, Journal of Cell Science, eLife, Frontiers in Pharmacology, Nature Structural & Molecular Biology, and bioRxiv. Research fields span ER membrane protein complex (EMC) function, membrane protein biogenesis and topogenesis, cholesterol homeostasis, mitochondrial lipid metabolism, ferroptosis, viral infection, and cell volume regulation.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Mechanism of an intramembrane chaperone for multipass membrane proteins; Authors - Luka Smalinskaitė
human	IF	Cell; WNK kinases sense molecular crowding and rescue cell volume via phase separation; Authors - Cary R Boyd-Shiwarski
human	WB	Cell; EMC Is Required to Initiate Accurate Membrane Protein Topogenesis.; Authors - Patrick J Chitwood
mouse,human	WB	Nat Commun; Mic19 depletion impairs endoplasmic reticulum-mitochondrial contacts and mitochondrial lipid metabolism and triggers liver disease; Authors - Jun Dong
human	WB	Nat Commun; The EMC acts as a chaperone for membrane proteins; Authors - Carolin J Klose
human	WB	Mol Cell; ATP13A1 prevents ERAD of folding-competent mislocalized and misoriented proteins; Authors - Michael J McKenna