TTDN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TTDN1 Polyclonal antibody, PBS Only (25410-1-PBS)

• 

  WB analysis of NIH/3T3 using 25410-1-AP (same clone as 25410-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 25410-1-AP (TTDN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25410-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 25410-1-AP (same clone as 25410-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 25410-1-AP (TTDN1 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25410-1-PBS in a different storage buffer formulation.

TTDN1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25410-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

C7orf11, ABHS, TTD non-photosensitive 1 protein, ORF20, MPLKIP

---

Product Information

25410-1-PBS targets TTDN1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22094

  Product name: Recombinant human C7orf11 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-179 aa of BC026265

  Sequence: MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC

• Full Name: chromosome 7 open reading frame 11
• Calculated Molecular Weight: 179 aa, 19 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC026265
• Gene Symbol: TTDN1
• Gene ID (NCBI): 136647
• RRID: AB_2935461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAP9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TTDN1 colocalizes with Plk1 at the centrosome in mitosis and the midbody during cytokinesis. It is phosphorylated by Cdk1 in mitosis, and this is required for its interaction with Plk1. Overexpression of TTDN1 or its knockdown by siRNA causes multi-polar spindles and multiple nuclei, suggesting that TTDN1 plays a role in regulating mitosis and cytokinesis. Mutations in the TTDN1 gene are associated with a distinct trichothiodystrophy phenotype. (PMID:17310276, 25290684)