Product Information
27433-1-PBS targets TUBD1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26626 Product name: Recombinant human TUBD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-134 aa of BC000258 Sequence: LSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYSVHGPRHEESIMNIIRKEVEKCDSFS Predict reactive species |
| Full Name | tubulin, delta 1 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 44 kda |
| GenBank Accession Number | BC000258 |
| Gene Symbol | TUBD1 |
| Gene ID (NCBI) | 51174 |
| RRID | AB_3669602 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UJT1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TUBD1, also named as TUBD, Tubulin delta chain, tubulin delta 1. The TUBD1 gene encodes a centrosomal protein of 453-amino acids with a molecular mass of 51 kD containing the canonical GTP-binding domain shared with other tubulins. TUBD1 mRNA is preferentially expressed in the sperm head, but it has been also detected in retina, heart, muscle, thyroid, ovary, and colon, among other tissues. At least 6 isoforms of the human protein are produced by alternative splicing (PMID: 28137601). The molecular weights of these 6 isoforms are 51, 45, 22, 27, 44, and 40 kDa, respectively.
