TUBGCP3 Polyclonal antibody

• 

  WB analysis of HeLa using 15719-1-AP

  WB result of TUBGCP3 antibody (15719-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-TUBGCP3 transfected HeLa cells.

• 

  WB analysis of Jurkat using 15719-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15719-1-AP (TUBGCP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

TUBGCP3 Polyclonal Antibody for WB, ELISA

Cat No. 15719-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, ELISA

Synonyms

GCP 3, GCP3, h104p, hGCP3, hGrip104, hSpc98, SPBC98, Spc98p, TUBGCP3

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 12 publications below
• IF: See 2 publications below

Product Information

15719-1-AP targets TUBGCP3 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8437

  Product name: Recombinant human TUBGCP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC007763

  Sequence: MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLED

• Full Name: tubulin, gamma complex associated protein 3
• Calculated Molecular Weight: 103.5 kDa
• Observed Molecular Weight: 95-101 kDa
• GenBank Accession Number: BC007763
• Gene Symbol: TUBGCP3
• Gene ID (NCBI): 10426
• RRID: AB_2211272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CW5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TUBGCP3, also named as γ‐tubulin complex protein 3, localized to the centrosome, is a member of γ-tubulin complex proteins which play key roles in microtubule nucleation and organization. It has been reported that TUBGCP3 rotation can bring γ-tubulin molecules into proximity. 15719-1-AP antibody detects the isoform proteins around 95-101 kDa and 50 kDa in SDS-PAGE.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; The dynamics of microtubule minus ends in the human mitotic spindle.; Authors - Nicolas Lecland
human	WB	Nat Commun; Structural mechanisms for centrosomal recruitment and organization of the microtubule nucleator γ-TuRC; Authors - Qi Gao
human	WB	Nat Commun; Modular assembly of the principal microtubule nucleator γ-TuRC.; Authors - Martin Würtz
mouse	WB	Nat Commun; Non-centrosomal nucleation mediated by augmin organizes microtubules in post-mitotic neurons and controls axonal microtubule polarity.; Authors - Carlos Sánchez-Huertas
human	WB,IF	J Cell Sci; MZT1 regulates microtubule nucleation by linking γTuRC assembly to adapter-mediated targeting and activation.; Authors - Rosa Ramírez Cota ; KD Validated
human	WB	J Cell Sci; Retromer/WASH dependent sorting of nutrient transporters requires a multivalent interaction network with ANKRD50.; Authors - Arunas Kvainickas