TUBGCP3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TUBGCP3 Polyclonal antibody (15719-1-AP)

• Featured Product
• KD/KO Validated

TUBGCP3 Polyclonal Antibody for WB, ELISA

Cat No. 15719-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, ELISA

Synonyms

GCP 3, GCP3, h104p, hGCP3, hGrip104, hSpc98, SPBC98, Spc98p, TUBGCP3

• 

  WB analysis of HeLa using 15719-1-AP

  WB result of TUBGCP3 antibody (15719-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-TUBGCP3 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 15719-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15719-1-AP (TUBGCP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TUBGCP3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15719-1-AP targets TUBGCP3 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8437

  Product name: Recombinant human TUBGCP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC007763

  Sequence: MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLED

• Full Name: tubulin, gamma complex associated protein 3
• Calculated Molecular Weight: 103.5 kDa
• Observed Molecular Weight: 95-101 kDa
• GenBank Accession Number: BC007763
• Gene Symbol: TUBGCP3
• Gene ID (NCBI): 10426
• RRID: AB_2211272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CW5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TUBGCP3, also named as γ‐tubulin complex protein 3, localized to the centrosome, is a member of γ-tubulin complex proteins which play key roles in microtubule nucleation and organization. It has been reported that TUBGCP3 rotation can bring γ-tubulin molecules into proximity. 15719-1-AP antibody detects the isoform proteins around 95-101 kDa and 50 kDa in SDS-PAGE.

Publications

What published studies show

The γ-tubulin antibody (Cat# 15719-1-AP) has 12 citations across journals including Nature Cell Biology, Nature Communications, Cell Reports, Journal of Biological Chemistry, Journal of Cell Science, Neural Regeneration Research, Cells, Frontiers in Molecular Neuroscience, and Journal of Neuropathology & Experimental Neurology. Research fields span microtubule nucleation and dynamics, centrosome organization, ciliogenesis, neuronal development, mast cell biology, retinal progenitor proliferation, and glioblastoma pathology.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; The dynamics of microtubule minus ends in the human mitotic spindle.; Authors - Nicolas Lecland
human	WB	Nat Commun; Structural mechanisms for centrosomal recruitment and organization of the microtubule nucleator γ-TuRC; Authors - Qi Gao
mouse	WB	Nat Commun; Non-centrosomal nucleation mediated by augmin organizes microtubules in post-mitotic neurons and controls axonal microtubule polarity.; Authors - Carlos Sánchez-Huertas
human	WB	Nat Commun; Modular assembly of the principal microtubule nucleator γ-TuRC.; Authors - Martin Würtz
human	WB	Neural Regen Res; GIT1 enhances neurite outgrowth by stimulating microtubule assembly.; Authors - Yi-Sheng Li
human	WB,IF	Cell Rep; Α γ-tubulin complex-dependent pathway suppresses ciliogenesis by promoting cilia disassembly; Authors - Sahana Shankar