TUBGCP5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TUBGCP5 Polyclonal antibody, PBS Only (14620-1-PBS)

• 

  WB analysis using 14620-1-AP (same clone as 14620-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14620-1-AP (TUBGCP5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14620-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 14620-1-AP (same clone as 14620-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14620-1-AP (TUBGCP5 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14620-1-PBS in a different storage buffer formulation.

TUBGCP5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14620-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Gamma-tubulin complex component 5, GCP5, GCP-5, KIAA1899

---

Product Information

14620-1-PBS targets TUBGCP5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6248

  Product name: Recombinant human TUBGCP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 676-1024 aa of BC071560

  Sequence: ESVTCQTFELTLRSCLYPHIDKQYLDCCGNLMQTLKKDYRLVEYLQAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSSRLSISFENVDTAKKKLPVHILDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDVLLFGELVSTAEKPRLKEGLIHEQDTVAQFGPQKEPVRQQIHRMFLLRVKLMHFVNSLHNYIMTRILHSTGLEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNLALMFADGWQAGLGTWRMESIEKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSLMAGMEQS

• Full Name: tubulin, gamma complex associated protein 5
• Calculated Molecular Weight: 118 kDa
• Observed Molecular Weight: 118-120 kDa
• GenBank Accession Number: BC071560
• Gene Symbol: TUBGCP5
• Gene ID (NCBI): 114791
• RRID: AB_2878070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RT8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.