Tested Applications
| Positive WB detected in | HEK-293 cells, SH-SY5Y cells, HeLa cells, SK-N-SH cells |
| Positive IP detected in | SH-SY5Y cells |
| Positive IHC detected in | human ovary cancer tissue, human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | hTERT-RPE1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13637-1-AP targets TULP3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4570 Product name: Recombinant human TULP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 96-442 aa of BC032587 Sequence: DEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFDEETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDYLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE Predict reactive species |
| Full Name | tubby like protein 3 |
| Calculated Molecular Weight | 442 aa, 50 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC032587 |
| Gene Symbol | TULP3 |
| Gene ID (NCBI) | 7289 |
| RRID | AB_2211547 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75386 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The tubby-like protein 3 (TULP3) has been identified as a member of tubby and tubby-like proteins (TULPs) that plays an important role in maintenance and function of neuronal cells during development and post-differentiation. Tulp3 gene is essential for embryonic development in mice. Recently TULP3 has been reported to bind to the IFT (intraflagellar transport)-A complex and promote trafficking of G protein-coupled receptors into primary cilia, which is implicated in regulating neuronal function.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TULP3 antibody 13637-1-AP | Download protocol |
| IHC protocol for TULP3 antibody 13637-1-AP | Download protocol |
| IP protocol for TULP3 antibody 13637-1-AP | Download protocol |
| WB protocol for TULP3 antibody 13637-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-TULP3 antibody (Cat# 13637-1-AP) has 20 citations. Journals include Nature, Nature Aging, Nature Communications, Science Advances, Cell Reports, Cell Communication & Signaling, Molecular Metabolism, Journal of Neuroscience, Journal of Biological Chemistry, Development, Frontiers in Neuroscience, Journal of Cell Science, PLoS Genetics, Life Science Alliance, Bioengineered, Biology Open, eLife, Molecular Cells, and bioRxiv. Research fields span primary cilia biology and ciliopathies, Sonic hedgehog and GLP-1 signaling, aging, neurodevelopment, kidney homeostasis, and lung cancer.
| Species | Application | Title |
|---|---|---|
Nature Lithocholic acid binds TULP3 to activate sirtuins and AMPK to slow down ageing
| ||
Nat Aging A primary cilia-autophagy axis in hippocampal neurons is essential to maintain cognitive resilience | ||
Nat Commun Identification of a component of the tubulin poly-glutamylase complex required for phosphoinositide homeostasis and cilium assembly and maintenance. | ||
Sci Adv Ciliopathy protein HYLS1 coordinates the biogenesis and signaling of primary cilia by activating the ciliary lipid kinase PIPKIγ. | ||
Cell Commun Signal Primary cilium and TULP3-dependent ciliary targeting of ACE2 in SARS-CoV-2 tropism.
| ||
Mol Cells Differential Roles of Tubby Family Proteins in Ciliary Formation and Trafficking. |
Reviews
What customers say
Reviews for this anti-TULP3 antibody are mixed. One user (1/5 stars) reported severe non-specific banding in Western blot at 1:1000 dilution in HEK293T cells, calling it ineffective for WB. Another user (5/5 stars) found it excellent for immunofluorescence at 1:200 in hTERT-RPE1 cells, confirming TULP3 accumulation in cilia and describing it as the best commercial anti-TULP3 available. Overall, the antibody appears well-suited for IF applications but problematic for Western blotting.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Evan (Verified Customer) (09-30-2019) | One of the worst antibodies I have ever used. I do not believe this antibody accurately detects Tulp3 by western blotting at all. The amount of non-specific bands at all sizes is so bad this antibody is pretty much only good for a protein stain. I have wasted weeks trying to get this antibody to work to no avail. Avoid this product for western blotting at all costs.
|
Francesc (Verified Customer) (09-19-2018) | We previously described that TULP3 (a PIP2-binding protein) accumulates in INPP5E-KO cilia, which also accumulate PIP2 (Garcia-Gonzalo et al. 2015 Dev Cell 34:400-409). We have successfully confirmed those results using Proteintech's anti-TULP3 antibody (13637-1-AP) in both mouse embryonic fibroblasts (MEFs, see my previous review) and in hTERT-RPE1 cells (here). This TULP3 antibody works beautifully, especially in human cells (it also works well in MEFs, but ciliary signal is less intense and lower dilution is needed). As far as I know, this is the best commercial anti-TULP3 available.
 |
