TWISTNB Polyclonal antibody

• 

  WB analysis of HeLa using 22784-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 22784-1-AP (TWISTNB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of THP-1 using 22784-1-AP

  THP-1 cells were subjected to SDS PAGE followed by western blot with 22784-1-AP (TWISTNB antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22784-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22784-1-AP (TWISTNB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 22784-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 22784-1-AP (TWISTNB antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TWISTNB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22784-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

TWIST neighbor, RPA43, RNA polymerase I subunit F, POLR1F, DNA-directed RNA polymerase I subunit RPA43

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, THP-1 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

22784-1-AP targets TWISTNB in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18783

  Product name: Recombinant human TWISTNB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-320 aa of BC130298

  Sequence: MAAGCSEAPRPAAASDGSLVGQAGVLPCLELPTYAAACALVNSRYSCLVAGPHQRHIALSPRYLNRKRTGIREQLDAELLRYSESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSSSHIGCLVHGCFNASIPKPEQLSAEQWQTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGTEEAAKKPKKKKKKKDPETYEVDSGTTKLADDADDTPMEESALQNTNNANGIWEEEPKKKKKKKKHQEVQDQDPVFQGSDSSGYQSDHKKKKKKRKHSEEAE

• Full Name: TWIST neighbor
• Calculated Molecular Weight: 338 aa, 37 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC130298
• Gene Symbol: TWISTNB
• Gene ID (NCBI): 221830
• RRID: AB_2879167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3B726
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biochim Biophys Acta Mol Cell Res; POLR1F promotes proliferation and stemness of anaplastic thyroid cancer by activating F2R/p38 MAPK signaling; Authors - Yingying Gong