• Featured Product
  • KD/KO Validated

Thioredoxin 1 Polyclonal antibody

Thioredoxin 1 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 14999-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (4)

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ELISA

thioredoxin, TXN, ADF, ATL-derived factor, Hom s Trx

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, K562 cells, MCF-7 cells, Jurkat cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman liver cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:9000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14999-1-AP targets Thioredoxin 1 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6989

Product name: Recombinant human TXN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-105 aa of BC003377

Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Predict reactive species
Full Name thioredoxin
Calculated Molecular Weight 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC003377
Gene Symbol TXN
Gene ID (NCBI) 7295
RRIDAB_2272597
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10599
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TXN, TRDX, TRX, TRX1, ADF and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.

Protocols

Product Specific Protocols
FC protocol for Thioredoxin 1 antibody 14999-1-APDownload protocol
IHC protocol for Thioredoxin 1 antibody 14999-1-APDownload protocol
IP protocol for Thioredoxin 1 antibody 14999-1-APDownload protocol
WB protocol for Thioredoxin 1 antibody 14999-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Crit Care

Recombinant ACE2 protein protects against acute lung injury induced by SARS-CoV-2 spike RBD protein.

Authors - Lingbing Zhang
mouseWB

Acta Pharm Sin B

Fluorine-thiol displacement probes for acetaminophen's hepatotoxicity

Authors - Benjamin L Prather
humanWB

Nat Commun

Cordycepin prevents radiation ulcer by inhibiting cell senescence via NRF2 and AMPK in rodents.

Authors - Ziwen Wang

Nano Converg

Detection of thioredoxin-1 using ultra-sensitive ELISA with enzyme-encapsulated human serum albumin nanoparticle.

Authors - Myeong-Jun Lee
humanWB

Cell Rep

CGG repeats in the human FMR1 gene regulate mRNA localization and cellular stress in developing neurons

Authors - Carissa L Sirois
mouseWB

Cell Rep

The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense.

Authors - Wu Hongtan H

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Amandine (Verified Customer) (02-07-2024)

20ug of protein, denatured or not, PVDF membrane, fast transfert, primary antibody 1/5000 1h30 RT, secondary antibody 1/5000 2h RT. Chemiluminescence revelation 10sec

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/5000
  • Cell Tissue Type: ImCC
Thioredoxin 1 Antibody Western Blot validation (1/5000 dilution) in ImCC (Cat no:14999-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...