Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, K562 cells, MCF-7 cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human liver cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:9000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 9 publications below |
| WB | See 85 publications below |
| IHC | See 9 publications below |
| IF | See 10 publications below |
| IP | See 6 publications below |
| ELISA | See 1 publications below |
| CoIP | See 3 publications below |
Product Information
14999-1-AP targets Thioredoxin 1 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6989 Product name: Recombinant human TXN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC003377 Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Predict reactive species |
| Full Name | thioredoxin |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC003377 |
| Gene Symbol | TXN |
| Gene ID (NCBI) | 7295 |
| RRID | AB_2272597 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10599 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TXN, TRDX, TRX, TRX1, ADF and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Thioredoxin 1 antibody 14999-1-AP | Download protocol |
| IHC protocol for Thioredoxin 1 antibody 14999-1-AP | Download protocol |
| IP protocol for Thioredoxin 1 antibody 14999-1-AP | Download protocol |
| WB protocol for Thioredoxin 1 antibody 14999-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Crit Care Recombinant ACE2 protein protects against acute lung injury induced by SARS-CoV-2 spike RBD protein. | ||
Nat Commun Cordycepin prevents radiation ulcer by inhibiting cell senescence via NRF2 and AMPK in rodents. | ||
Nano Converg Detection of thioredoxin-1 using ultra-sensitive ELISA with enzyme-encapsulated human serum albumin nanoparticle. | ||
Cell Rep CGG repeats in the human FMR1 gene regulate mRNA localization and cellular stress in developing neurons | ||
Cell Rep The Ets transcription factor GABP is a component of the hippo pathway essential for growth and antioxidant defense. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Amandine (Verified Customer) (02-07-2024) | 20ug of protein, denatured or not, PVDF membrane, fast transfert, primary antibody 1/5000 1h30 RT, secondary antibody 1/5000 2h RT. Chemiluminescence revelation 10sec
![]() |














