Tested Applications
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL647-14999 targets Thioredoxin in FC (Intra) applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6989 Product name: Recombinant human TXN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC003377 Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Predict reactive species |
Full Name | thioredoxin |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC003377 |
Gene Symbol | TXN |
Gene ID (NCBI) | 7295 |
RRID | AB_2934908 |
Conjugate | CoraLite® Plus 647 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P10599 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
TXN, TRDX, TRX, TRX1, ADF and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.
Protocols
Product Specific Protocols | |
---|---|
FC protocol for CL Plus 647 Thioredoxin antibody CL647-14999 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |