• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Thioredoxin Polyclonal antibody

Thioredoxin Polyclonal Antibody for FC (Intra)
Cat No. CL488-14999

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

TXN, TRDX, THIO, Surface-associated sulphydryl protein, Hom s Trx

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14999 targets Thioredoxin in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6989

Product name: Recombinant human TXN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-105 aa of BC003377

Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Predict reactive species
Full Name thioredoxin
Calculated Molecular Weight 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC003377
Gene Symbol TXN
Gene ID (NCBI) 7295
RRIDAB_2919107
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP10599
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TXN, TRDX, TRX, TRX1, ADF and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Thioredoxin antibody CL488-14999Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...