Home
Products
Primary Antibodies
TXNDC17 Polyclonal antibody, PBS Only (20811-1-PBS)

Filter: AllWBIPIF/ICC

WB analysis using 20811-1-AP (same clone as 20811-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 20811-1-AP (TXNDC17 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 20811-1-AP (same clone as 20811-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 20811-1-AP (TXNDC17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 20811-1-AP (same clone as 20811-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 20811-1-AP (TXNDC17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 20811-1-AP (same clone as 20811-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 20811-1-AP (TXNDC17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
WB analysis of K-562 using 20811-1-AP (same clone as 20811-1-PBS)
K-562 cells were subjected to SDS PAGE followed by western blot with 20811-1-AP (TXNDC17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
WB analysis of human kidney using 20811-1-AP (same clone as 20811-1-PBS)
human kidney tissue were subjected to SDS PAGE followed by western blot with 20811-1-AP (TXNDC17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
WB analysis of mouse pancreas using 20811-1-AP (same clone as 20811-1-PBS)
mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 20811-1-AP (TXNDC17 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
WB analysis of human uterus using 20811-1-AP (same clone as 20811-1-PBS)
human uterus tissue were subjected to SDS PAGE followed by western blot with 20811-1-AP (TXNDC17 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
WB analysis of L02 using 20811-1-AP (same clone as 20811-1-PBS)
L02 cells were subjected to SDS PAGE followed by western blot with 20811-1-AP (TXNDC17 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
IP experiment of HEK-293 using 20811-1-AP (same clone as 20811-1-PBS)
IP result of anti-TXNDC17 (IP:20811-1-AP, 4ug; Detection:20811-1-AP 1:6000) with HEK-293 cells lysate 1575 ug. This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 20811-1-AP (same clone as 20811-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TXNDC17 antibody (20811-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 20811-1-AP (same clone as 20811-1-PBS)
Immunofluorescent analysis of Hela cells, using TXNDC17 antibody 20811-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 20811-1-AP (same clone as 20811-1-PBS)
Immunofluorescent analysis of HepG2 cells, using TXNDC17 antibody 20811-1-AP at 1:25 dilution and FITC- labeled donkey anti-Rabbit IgG (green). This data was developed using the same antibody clone with 20811-1-PBS in a different storage buffer formulation.

TXNDC17 Polyclonal antibody, PBS Only

Name: TXNDC17 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 20811-1-PBS

TXNDC17 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 20811-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

TXNL5, TRP14, Thioredoxin-like protein 5, Thioredoxin domain-containing protein 17, Protein 42-9-9

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

20811-1-PBS targets TXNDC17 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14766 Product name: Recombinant human TXNDC17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC006405 Sequence: MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED Predict reactive species
Full Name	thioredoxin domain containing 17
Calculated Molecular Weight	123 aa, 14 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC006405
Gene Symbol	TXNDC17
Gene ID (NCBI)	84817
RRID	AB_10695499
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9BRA2
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

TXNDC17 also known as TRP14, TXNL5, belongs to the thioredoxin family. TRP14 is a widely expressed, 123-amino acid protein with a WCPDC motif. TXNDC17 has a thioredoxin fold and a TRX-like active-site sequence(PMID: 14607844, 24778250).