TXNDC6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TXNDC6 Polyclonal antibody (21235-1-AP)

• 

  WB analysis using 21235-1-AP

  K-562 cell lysates were subjected to SDS PAGE followed by western blot with 21235-1-AP (TXNDC6 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

TXNDC6 Polyclonal Antibody for WB, ELISA

Cat No. 21235-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

NME9, Thioredoxin like protein 2, TXL 2, TXL2

---

Tested Applications

• Positive WB detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21235-1-AP targets TXNDC6 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15719

  Product name: Recombinant human TXNDC6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC107054

  Sequence: MLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYAIKDEALSDEDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGE

• Full Name: thioredoxin domain containing 6
• Calculated Molecular Weight: 263 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC107054
• Gene Symbol: TXNDC6
• Gene ID (NCBI): 347736
• RRID: AB_3742024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86XW9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thioredoxin domain-containing protein 6 (TXNDC6), also known as NME/NM23 family member 9 (NME9) or thioredoxin-like protein 2 (Txl-2), belongs to the group II NME/NDK (nucleoside diphosphate kinase) family and is a member of the thioredoxin (Trx) superfamily. Although the precise physiological function of TXNDC6 remains unclear, current evidence suggests it may act as a regulator of microtubule physiology.