TXNDC9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86826-5-RR (same clone as 86826-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86826-5-RR (TXNDC9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86826-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86826-5-RR

  Biolayer interferometry (BLl) kinetic assays of 86826-5-RR against Human TXNDC9 were performed. The affinity constant is below 1 pM.

TXNDC9 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86826-5-PBS

Clone No.251866B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

APACD, ATP-binding protein associated with cell differentiation, PHLP3, Protein 1 4, Protein 1-4

---

Product Information

86826-5-PBS targets TXNDC9 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19509

  Product name: Recombinant human TXNDC9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-226 aa of BC005968

  Sequence: MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD

• Full Name: thioredoxin domain containing 9
• Calculated Molecular Weight: 226 aa, 27 kDa
• Observed Molecular Weight: 25-27 kDa
• GenBank Accession Number: BC005968
• Gene Symbol: TXNDC9
• Gene ID (NCBI): 10190
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14530
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TXNDC9, also known as APACD, has a negative effect on protein folding by significantly reducing the activity of chaperone protein TCP1 complex ATPase activity. Including actin or tubulin.