TXNL4B Polyclonal antibody

• 

  WB analysis of HEK-293 using 12927-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12927-1-AP (TXNL4B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

TXNL4B Polyclonal Antibody for WB, ELISA

Cat No. 12927-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

Dim1 like protein, DIM2, DLP, thioredoxin like 4B, Thioredoxin like protein 4B, TXNL4B

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

12927-1-AP targets TXNL4B in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3620

  Product name: Recombinant human TXNL4B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-149 aa of BC009646

  Sequence: MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

• Full Name: thioredoxin-like 4B
• Calculated Molecular Weight: 149 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC009646
• Gene Symbol: TXNL4B
• Gene ID (NCBI): 54957
• RRID: AB_2877893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TXNL4B(Thioredoxin-like protein 4B) is also named as DIM2, DLP and belongs to the DIM1 family. It is implicated in not only cell cycle progression but also in a more specific molecular process such as pre-mRNA splicing. It is required for S/G(2) transition.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	MedComm (2020); TXNL4B regulates radioresistance by controlling the PRP3-mediated alternative splicing of FANCI; Authors - Zhao Ju ; KD Validated