TXNL4B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TXNL4B Polyclonal antibody (12927-1-AP)

TXNL4B Polyclonal Antibody for WB, ELISA

Cat No. 12927-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

Dim1 like protein, DIM2, DLP, thioredoxin like 4B, Thioredoxin like protein 4B, TXNL4B

• 

  WB analysis of HEK-293 using 12927-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12927-1-AP (TXNL4B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TXNL4B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12927-1-AP targets TXNL4B in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3620

  Product name: Recombinant human TXNL4B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-149 aa of BC009646

  Sequence: MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

• Full Name: thioredoxin-like 4B
• Calculated Molecular Weight: 149 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC009646
• Gene Symbol: TXNL4B
• Gene ID (NCBI): 54957
• RRID: AB_2877893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TXNL4B(Thioredoxin-like protein 4B) is also named as DIM2, DLP and belongs to the DIM1 family. It is implicated in not only cell cycle progression but also in a more specific molecular process such as pre-mRNA splicing. It is required for S/G(2) transition.

Publications

What published studies show

The TXNL4B Polyclonal antibody (Cat# 12927-1-AP) has 1 citation. It appears in MedComm (Impact Factor 14.1), published in 2023. The study investigated how TXNL4B regulates radioresistance by controlling PRP3-mediated alternative splicing of FANCI, placing it in the research fields of RNA splicing, radiation biology, and Fanconi anemia pathway. The antibody was validated in human samples for WB, IHC, and IF applications.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	MedComm (2020); TXNL4B regulates radioresistance by controlling the PRP3-mediated alternative splicing of FANCI; Authors - Zhao Ju ; KD Validated