TYMS Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TYMS Recombinant monoclonal antibody, PBS Only (86643-1-PBS)

TYMS Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 86643-1-PBS

Clone No.251532A1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Thymidylate synthase, DKCD, EC:2.1.1.45, HsT422, OK/SW-cl.29

• 

  WB analysis using 86643-1-RR (same clone as 86643-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86643-1-RR (TYMS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86643-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human rectal cancer using 86643-1-RR (same clone as 86643-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 86643-1-RR (TYMS antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86643-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 86643-1-RR (same clone as 86643-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 86643-1-RR (TYMS antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86643-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 86643-1-RR (same clone as 86643-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TYMS antibody (86643-1-RR, Clone: 251532A1 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86643-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 86643-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86643-1-RR against Human TYMS were performed. The affinity constant is 0.284 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86643-1-PBS targets TYMS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7027

  Product name: Recombinant human TYMS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-313 aa of BC002567

  Sequence: MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV

• Full Name: thymidylate synthetase
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC002567
• Gene Symbol: TYMS
• Gene ID (NCBI): 7298
• RRID: AB_3745024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04818
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.