TYRO3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TYRO3 Polyclonal antibody, PBS Only (28513-1-PBS)

• 

  WB analysis using 28513-1-AP (same clone as 28513-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28513-1-AP (TYRO3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28513-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 28513-1-AP (same clone as 28513-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28513-1-AP (TYRO3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28513-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 28513-1-AP (same clone as 28513-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28513-1-AP (TYRO3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28513-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28513-1-AP (same clone as 28513-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28513-1-AP (TYRO3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28513-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28513-1-AP (same clone as 28513-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28513-1-AP (TYRO3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28513-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HCT 116 using 28513-1-AP (same clone as 28513-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HCT 116 cells using TYRO3 antibody (28513-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 28513-1-PBS in a different storage buffer formulation.

TYRO3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 28513-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Brt, BYK, Dtk, EC:2.7.10.1, RSE

---

Product Information

28513-1-PBS targets TYRO3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29540

  Product name: Recombinant human TYRO3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 451-596 aa of BC049368

  Sequence: LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL

• Full Name: TYRO3 protein tyrosine kinase
• Calculated Molecular Weight: 97 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC049368
• Gene Symbol: TYRO3
• Gene ID (NCBI): 7301
• RRID: AB_2881162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q06418
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TYRO3 has a structure includes a cytoplasmic domain and an extracellular ligand binding region. And ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. TYRO3 is associated with many physiological processes including cell survival, migration and differentiation. It has been reported that TYRO3 can be expressed in various regions of the mammalian central nervous system. 28513-1-AP antibody recognizes the 97 kDa and 140 kDa protein which might be the glycosylated form similar to the papers.((PMID: 8873131, 23354874, 21539887)