TYRO3 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01701-3

  Sandwich ELISA standard curve of MP01701-3, Human TYRO3 Recombinant Matched Antibody Pair - PBS only. 84929-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag29527. 84929-5-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL.

• 

  Sample test of MP01701-3

  The mean TYRO3 concentration was determined to be 19.82 ng/mL in HT-29 cell extract based on a 1.50 mg/mL extract load, 25.19 ng/mL in COLO 320 cell extract based on a 1.40 mg/mL extract load and 20.61 ng/mL in SGC-7901 cell extract based on a 1.60 mg/mL extract load.

TYRO3 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84929-5-PBS

Clone No.242477E12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

RSE, EC:2.7.10.1, Dtk, BYK, Brt

---

Product Information

84929-5-PBS targets TYRO3 as part of a matched antibody pair:

MP01701-3: 84929-4-PBS capture and 84929-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29527

  Product name: Recombinant human TYRO3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 451-596 aa of BC049368

  Sequence: LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL

• Full Name: TYRO3 protein tyrosine kinase
• Calculated Molecular Weight: 97 kDa
• GenBank Accession Number: BC049368
• Gene Symbol: TYRO3
• Gene ID (NCBI): 7301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q06418
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.