TYRO3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84929-6-RR (same clone as 84929-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84929-6-RR (TYRO3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84929-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84929-6-RR (same clone as 84929-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84929-6-RR (TYRO3 antibody) at dilution of 1:250 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84929-6-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84929-6-RR (same clone as 84929-6-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84929-6-RR (TYRO3 antibody) at dilution of 1:250 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84929-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84929-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84929-6-RR against Human TYRO3 were performed. The affinity constant is 0.133 nM.

TYRO3 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84929-6-PBS

Clone No.242477G1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

RSE, EC:2.7.10.1, Dtk, BYK, Brt

---

Product Information

84929-6-PBS targets TYRO3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29527

  Product name: Recombinant human TYRO3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 451-596 aa of BC049368

  Sequence: LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL

• Full Name: TYRO3 protein tyrosine kinase
• Calculated Molecular Weight: 97 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC049368
• Gene Symbol: TYRO3
• Gene ID (NCBI): 7301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q06418
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TYRO3 has a structure includes a cytoplasmic domain and an extracellular ligand binding region. And ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. TYRO3 is associated with many physiological processes including cell survival, migration and differentiation. It has been reported that TYRO3 can be expressed in various regions of the mammalian central nervous system. The molecular mass of TYRO3 is 130 kDa, the apparent molecular mass is higher due to glycosylation.((PMID: 8873131, 23354874, 21539887)