TRP1 Polyclonal antibody

• 

  WB analysis using 16672-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16672-1-AP (TRP1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

TRP1 Polyclonal Antibody for WB, ELISA

Cat No. 16672-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

TYRP1, DHICA oxidase, CATB, Catalase B, CAS2

---

Tested Applications

• Positive WB detected in: A375 cells, A431 cells, mouse retina tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

16672-1-AP targets TRP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10166

  Product name: Recombinant human TYRP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-399 aa of BC052608

  Sequence: QFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPI

• Full Name: tyrosinase-related protein 1
• Calculated Molecular Weight: 537 aa, 61 kDa
• Observed Molecular Weight: ~70 kDa
• GenBank Accession Number: BC052608
• Gene Symbol: TRP1
• Gene ID (NCBI): 7306
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17643
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int J Mol Sci; Inhibition of Melanogenesis by Gallic Acid: Possible Involvement of the PI3K/Akt, MEK/ERK and Wnt/β-Catenin Signaling Pathways in B16F10 Cells.; Authors - Su Tzu-Rong TR
mouse	WB	Heliyon; Exploring the potential of white birch sap: A natural alternative to traditional skin whitening agents with reduced side effects; Authors - Fan Liu