Tesmin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Tesmin Polyclonal antibody (33326-1-AP)

• 

  WB analysis using 33326-1-AP

  Human testis tissue were subjected to SDS PAGE followed by western blot with 33326-1-AP (Tesmin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Tesmin Polyclonal Antibody for WB, ELISA

Cat No. 33326-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Metallothionein-like 5, testis-specific, MTL5, Testis-specific metallothionein-like protein

---

Tested Applications

• Positive WB detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33326-1-AP targets Tesmin in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39255

  Product name: Recombinant human MTL5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 158-306 aa of NM_004923.3

  Sequence: VEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAG

• Full Name: metallothionein-like 5, testis-specific (tesmin)
• Calculated Molecular Weight: 55kDa，508aa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_004923.3
• Gene Symbol: MTL5
• Gene ID (NCBI): 9633
• RRID: AB_3742940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y4I5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Testis Expressed Metallothionein Like Protein (Tesmin), also known as Metallothionein-Like 5 (MTL5), encodes the metallothionein-like protein owning some characteristics of metallothionein. Tesmin is a 60 kDa protein which has cysteine-rich motifs (CXC domain), characteristic of metallothioneins (MTs). Tesmin was closely related to meiosis in the reproductive process. As a testis-specific protein, the localization of Tesmin changed dynamically with the progression of meiosis in a mouse experiment, the process of which might be responsive to metal stress like cadmium by oxidative stress (Cd), as well as require the involvement of LIN9. So far, the expression of Tesmin in adult humans has been observed in prostate and gastric cancer (PMID: 39229988, PMID: 33281959, PMID: 31059101).