Thrombospondin 1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Thrombospondin 1 Recombinant monoclonal antibody, PBS Only (88117-1-PBS)

Thrombospondin 1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88117-1-PBS

Clone No.260191E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

THBS1, Thrombospondin-1, Glycoprotein G, THBS, THBS 1

• 

  WB analysis using 88117-1-RR (same clone as 88117-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88117-1-RR (Thrombospondin 1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88117-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MDA-MB-231 using 88117-1-RR (same clone as 88117-1-PBS)

  MDA-MB-231 cells were subjected to SDS PAGE followed by western blot with 88117-1-RR (Thrombospondin 1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88117-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88117-1-PBS targets Thrombospondin 1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29129

  Product name: Recombinant human THBS1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-250 aa of NM_003246

  Sequence: GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS

• Full Name: thrombospondin 1
• Calculated Molecular Weight: 129 kDa
• Observed Molecular Weight: 160-180 kDa
• GenBank Accession Number: NM_003246
• Gene Symbol: Thrombospondin 1
• Gene ID (NCBI): 7057
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07996
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Thrombospondin 1(TSP-1), an extracellular matrix protein, is the first identified natural angiogenesis inhibitor. A variety of normal cells, including endothelial cells, fibroblasts, adipocytes, smooth muscle cells, monocytes, macrophages, and transformed cells such as malignant glioma cells, secrete Thrombospondin 1. It regulates cellular phenotype during tissue genesis and repair. It acts as a molecular facilitator by bringing together cytokines, growth factors, matrix components, membrane receptors and extracellular proteases. Thrombospondin 1 binds to a wide variety of integrin and non-integrin cell surface receptors. It is also a major activator of transforming growth factor (TGFβ1). Secreted TSP1 is a glycoprotein with a molecular mass of 150-180 kDa.