• Featured Product
  • KD/KO Validated

Timp-3 Polyclonal antibody

Timp-3 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 10858-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

TIMP3, Protein MIG-5, Protein MIG 5, Metalloproteinase inhibitor 3, K222TA2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, mouse brain tissue, rat brain tissue
Positive IHC detected inhuman stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10858-1-AP targets Timp-3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1253

Product name: Recombinant human Timp-3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-211 aa of BC014277

Sequence: MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

Predict reactive species
Full Name TIMP metallopeptidase inhibitor 3
Calculated Molecular Weight 24 kDa
Observed Molecular Weight 20-30 kDa
GenBank Accession NumberBC014277
Gene Symbol TIMP3
Gene ID (NCBI) 7078
RRIDAB_2204973
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35625
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Timp-3 (TIMP metallopeptidase inhibitor 3), also known as SFD. It is expected to be located in extracellular space, and the protein is enriched in the placenta tissue and fat tissue. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation, and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. TIMP-3 is expressed as an unglycosylated 24 kDa and glycosylated 29 kDa protein with inhibitory activity against interstitial collagenase, stromelysin-1, and gelatinases A and B (PMID:11827795).

Protocols

Product Specific Protocols
IHC protocol for Timp-3 antibody 10858-1-APDownload protocol
WB protocol for Timp-3 antibody 10858-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Theranostics

miR-17-3p Contributes to Exercise-Induced Cardiac Growth and Protects against Myocardial Ischemia-Reperfusion Injury.

Authors - Jing Shi
humanIHC

Oxid Med Cell Longev

Trehalose Protects Keratinocytes against Ultraviolet B Radiation by Activating Autophagy via Regulating TIMP3 and ATG9A.

Authors - Li Li
human

Int Immunopharmacol

Sublytic C5b-9 induces TIMP3 expression by glomerular mesangial cells via TRAF6-dependent KLF5 K63-linked ubiquitination in rat Thy-1 nephritis

Authors - Shuai Ying
IHC

Sci Rep

AMPK deficiency in chondrocytes accelerated the progression of instability-induced and ageing-associated osteoarthritis in adult mice.

Authors - Sheng Zhou
IHC

Cell Prolif

Aspirin inhibits inflammation and scar formation in the injury tendon healing through regulating JNK/STAT-3 signalling pathway.

Authors - Yunjiao Wang

Biomolecules

Tau Protein Modulates Perineuronal Extracellular Matrix Expression in the TauP301L-acan Mouse Model.

Authors - Sophie Schmidt
Loading...
||
New chat Able
正在加载,请稍候...