Tissue Factor/CD142 Polyclonal antibody, PBS Only

Tissue Factor/CD142 Polyclonal Antibody for WB, Indirect ELISA
Cat No. 31453-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

CD142, Coagulation factor III, F3, Tissue factor, TF

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

31453-1-PBS targets Tissue Factor/CD142 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Eg1052

Product name: Recombinant Human Coagulation Factor III/Tissue Factor protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 33-251 aa of NM_001993.5

Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Predict reactive species
Full Name coagulation factor III (thromboplastin, tissue factor)
Calculated Molecular Weight33 kDa
Observed Molecular Weight45-53 kDa
GenBank Accession NumberNM_001993.5
Gene Symbol F3
Gene ID (NCBI) 2152
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP13726-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108).

Loading...
||
New chat Able
正在加载,请稍候...