Anti-Human Tissue Factor/CD142 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using 98104-1-RR

  1x10^6 untreated or LPS-treated human PBMCs were surface stained with 0.25 ug Anti-Human Tissue Factor/CD142 Rabbit RecAb (98104-1-RR, Clone: 240784E2) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with APC Anti-Human CD14. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98104-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98104-1-RR against Human Tissue Factor/CD142 were performed. The affinity constant is 0.834 nM.

Tissue Factor/CD142 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98104-1-RR

Clone No.240784E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD142, Coagulation factor III, F3, Tissue factor, 240784E2

---

Tested Applications

• Positive FC detected in: LPS treated human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98104-1-RR targets Tissue Factor/CD142 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1052

  Product name: Recombinant Human Coagulation Factor III/Tissue Factor protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 33-251 aa of NM_001993.5

  Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

• Full Name: coagulation factor III (thromboplastin, tissue factor)
• Calculated Molecular Weight: 33 kDa
• GenBank Accession Number: NM_001993.5
• Gene Symbol: F3
• Gene ID (NCBI): 2152
• RRID: AB_3672251
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P13726-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named CD142, coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108).