Tissue Factor/CD142 Polyclonal antibody

• 

  WB analysis using 28005-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28005-1-AP (Tissue Factor antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 28005-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28005-1-AP (Tissue Factor antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Tissue Factor/CD142 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28005-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CD142, Coagulation factor III, F3, Tissue factor, TF

---

Tested Applications

• Positive WB detected in: A431 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

28005-1-AP targets Tissue Factor/CD142 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27553

  Product name: Recombinant human F3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 113-251 aa of BC011029

  Sequence: GNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

• Full Name: coagulation factor III (thromboplastin, tissue factor)
• Calculated Molecular Weight: 295 aa, 33 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC011029
• Gene Symbol: F3
• Gene ID (NCBI): 2152
• RRID: AB_3669635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13726
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Acta Pharmacol Sin; Lethal pulmonary thromboembolism in mice induced by intravenous human umbilical cord mesenchymal stem cell-derived large extracellular vesicles in a dose- and tissue factor-dependent manner; Authors - Bian-Lei Yang