Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TLR4 Polyclonal antibody

TLR4 Polyclonal Antibody for WB, IHC, IF-Fro, ELISA

Cat No. 19811-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF-Fro, IP, CoIP, ChIP, ELISA, Blocking assay, Microtiter plate binding assay, Western Blot

ARMD10, CD284, hToll, TOLL, toll like receptor 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, mouse liver tissue, RAW 264.7 cells, J774A.1 cells
Positive IHC detected inhuman placenta tissue, mouse brain tissue, human liver cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-Fro detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19811-1-AP targets TLR4 in WB, IHC, IF-Fro, IP, CoIP, ChIP, ELISA, Blocking assay, Microtiter plate binding assay, Western Blot applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, chicken, zebrafish, hamster, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13841

Product name: Recombinant human TLR4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 653-839 aa of BC117422

Sequence: KFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI

Predict reactive species
Full Name toll-like receptor 4
Calculated Molecular Weight 839 aa, 96 kDa
Observed Molecular Weight 90-110 kDa
GenBank Accession NumberBC117422
Gene Symbol TLR4
Gene ID (NCBI) 7099
RRIDAB_10638446
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00206
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TLR4, also named CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP, and TRAF6, leading to NF-kB activation, cytokine secretion, and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described. The calculated molecular weights of the three TLR4 isoforms are 96, 91, and 73 kDa.

Protocols

Product Specific Protocols
IF protocol for TLR4 antibody 19811-1-APDownload protocol
IHC protocol for TLR4 antibody 19811-1-APDownload protocol
WB protocol for TLR4 antibody 19811-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Adv Mater

Biomimetic Immunosuppressive Exosomes that Inhibit Cytokine Storms Contribute to the Alleviation of Sepsis.

Authors - Yinan Li
humanIF

Adv Sci (Weinh)

Turmeric-Derived Nanoparticles Functionalized Aerogel Regulates Multicellular Networks to Promote Diabetic Wound Healing

Authors - Bodeng Wu
WB

Adv Sci (Weinh)

Elevated Histone Lactylation Mediates Ferroptosis Resistance in Endometriosis Through the METTL3-Regulated HIF1A/HMOX1 Signaling Pathway

Authors - Zongwen Liang
humanELISA

J Clin Invest

Longistatin in tick saliva blocks advanced glycation end-product receptor activation.

Authors - Takeshi Anisuzzaman
humanWB

Gut Microbes

Fusobacterium nucleatum promotes esophageal squamous cell carcinoma progression and chemoresistance by enhancing the secretion of chemotherapy-induced senescence-associated secretory phenotype via activation of DNA damage response pathway

Authors - Jian-Wei Zhang
mouseWB,IF

Nat Commun

TLR4 signalling via Piezo1 engages and enhances the macrophage mediated host response during bacterial infection.

Authors - Jing Geng

Reviews

    4.8 out of 5
Add a review

5 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sai Sindhura (Verified Customer) (03-23-2026)

TLR4 antibody works very well

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000

Iram (Verified Customer) (03-23-2026)

It gives very sharp bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Colon cancer

Mounika (Verified Customer) (01-08-2026)

Excellent bands, Good while observing under confocal microscope, eased out our project

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000

Iram (Verified Customer) (12-19-2025)

Works well for IB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 for IB
  • Cell Tissue Type: CRC cells

Sara (Verified Customer) (10-25-2020)

B cells (mouse) were lysated in RIPA buffer with protein and phosphatase inhibitors. 10 µg of protein per lane were loaded in a 10% PAGE-SDS gel. Proteins were transferred to a PVFD membrane (Turbo Blot system) and incubated overnight with 1:1000 of anti-TLR4, followed by anti-rabbit-HRP (1:10.000) on the next day. Two bands of around 70 kDa are detected.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Primary B cells from mouse spleen
TLR4 Antibody Western Blot validation (1:1000 dilution) in Primary B cells from mouse spleen (Cat no:19811-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...