Anti-Mouse TLR4/CD284 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of Balb/c mouse peritoneal macrophages using 98018-1-RR (same clone as 98018-1-PBS)

  1x10^6 Balb/c mouse peritoneal macrophages were surface stained with 0.25 ug Anti-Mouse TLR4/CD284 Rabbit Recombinant Antibody (98018-1-RR, Clone: 230463C7) or 0.25 ug Isotype Control, and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Mouse CD11b (M1/70) (APC-65055, Clone: M1/70). Cells were not fixed. This data was developed using the same antibody clone with 98018-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Balb/c mouse peritoneal macrophages using 98018-1-RR (same clone as 98018-1-PBS)

  1x10^6 Balb/c mouse peritoneal macrophages were surface stained with 0.25 ug Anti-Mouse TLR4/CD284 Rabbit Recombinant Antibody (98018-1-RR, Clone: 230463C7) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (red), or 0.25 ug Isotype Control and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (blue). Cells were not fixed. This data was developed using the same antibody clone with 98018-1-PBS in a different storage buffer formulation.

TLR4/CD284 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98018-1-PBS

Clone No.230463C7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Tlr4, CD284, toll like receptor 4, 230463C7

---

Product Information

98018-1-PBS targets TLR4/CD284 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32998

  Product name: Recombinant mouse Tlr4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 198-395 aa of NM_021297

  Sequence: RENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLG

• Full Name: toll-like receptor 4
• Calculated Molecular Weight: 96 kDa
• GenBank Accession Number: NM_021297
• Gene Symbol: Tlr4
• Gene ID (NCBI): 21898
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9QUK6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TLR4, also named as CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP and TRAF6, leading to NF-kB activation, cytokine secretion and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described.