Mouse TNFR2/CD120b Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00337-1

  Sandwich ELISA standard curve of MP00337-1, Mouse TNFR2/CD120b Recombinant Matched Antibody Pair - PBS only. 83313-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0683. 83313-1-PBS was HRP conjugated as the detection antibody. Range: 15.6-1000 pg/mL.

• 

  Sample test of MP00337-1

  Serum of sixteen mice was measured. The TNFR2/CD120b concentration of detected samples was determined to be 6361.1 pg/mL with a range of 3,703.9 - 11,725.6 pg/mL.

• 

  Sample test of MP00337-1

  Mouse lung conditioned media cultured in RPMI supplemented with 10% fetal bovine serum was collected after culturing for 5 days. An aliquot of the cell culture supernatant was removed, assayed for mouse TNFR2/CD120b and measured 1,202.7 pg/mL.

• 

  Cytometric bead array standard curve of MP00337-1

  Cytometric bead array standard curve of MP00337-1, TNFR2/CD120b Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83313-3-PBS. Detection antibody: 83313-1-PBS. Standard: Eg0075. Range: 0.313-40 ng/mL.

TNFR2/CD120b Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83313-1-PBS

Clone No.240200C12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD120b, TNFR2, Tnfrsf1b, p75, TNF alphaR2

---

Product Information

83313-1-PBS targets TNFR2/CD120b as part of a matched antibody pair:

MP00337-1: 83313-3-PBS capture and 83313-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0683

  Product name: Recombinant mouse Tnfrsf1b protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 23-258 aa of NM_011610.3

  Sequence: VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG

• Full Name: tumor necrosis factor receptor superfamily, member 1b
• Calculated Molecular Weight: 50KD
• GenBank Accession Number: NM_011610.3
• Gene Symbol: Tnfrsf1b
• Gene ID (NCBI): 21938
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q545P4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.