Transferrin Receptor 2/TFR2 Polyclonal antibody

Transferrin Receptor 2/TFR2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 32381-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

TFR2, Transferrin receptor protein 2, transferrin receptor 2, TFRC2, HFE3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

32381-1-AP targets Transferrin Receptor 2/TFR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag37959

Product name: Recombinant human TFR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 105-310 aa of BC142630

Sequence: RGSCQACGDSVLVVSEDVNYEPDLDFHQGRLYWSDLQAMFLQFLGEGRLEDTIRQTSLRERVAGSAGMAALTQDIRAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDPDVYCPYSAIGNVTGELVYAHYGRPEDLQDLRARGVDPVGRLLLVRVGVISFAQKVTNAQDFGAQGVLIYPEPADFSQDPPK

Predict reactive species
Full Name transferrin receptor 2
Calculated Molecular Weight 801 aa, 89 kDa
Observed Molecular Weight88-97 kDa
GenBank Accession NumberBC142630
Gene Symbol TFR2
Gene ID (NCBI) 7036
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ9UP52
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transferrin Receptor 2 (TFR2) is a type II transmembrane glycoprotein that plays a crucial role in iron homeostasis. It is highly homologous to Transferrin Receptor 1 (TFR1) and is primarily expressed in the liver and erythroid precursor cells. TFR2 is involved in the regulation of hepcidin, a hormone that controls iron absorption and distribution in the body. It helps mediate the cellular uptake of iron-bound transferrin, although its affinity for iron is lower than that of TFR1 (PMID: 24658816). It is more involved in sensing iron levels and regulating hepcidin expression rather than direct iron uptake. TFR2 is predominantly expressed in hepatocytes (liver cells) and erythroid precursors (cells that give rise to red blood cells). It is also found in the enterocytes of the small intestine (PMID: 29969719). In the liver, TFR2 acts as a sensor for circulating iron-bound transferrin and helps regulate hepcidin production. Hepcidin, in turn, controls iron absorption from the diet and iron release from macrophages. The molecular weight of TFR2 is 88 kDa, its observed molecular weight is 88-97 kDa.

Protocols

Product Specific Protocols
IHC protocol for Transferrin Receptor 2/TFR2 antibody 32381-1-APDownload protocol
WB protocol for Transferrin Receptor 2/TFR2 antibody 32381-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...