UBA6 Polyclonal antibody

• 

  WB analysis using 13211-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13211-1-AP (UBA6 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 13211-1-AP

  WB result of UBA6 antibody (13211-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-UBA6 transfected HEK-293 cells.

• 

  WB analysis of human brain using 13211-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13211-1-AP (UBA6 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 13211-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13211-1-AP (UBA6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 13211-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13211-1-AP (UBA6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 13211-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13211-1-AP (UBA6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 13211-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13211-1-AP (UBA6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 13211-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using 13211-1-AP (UBA6 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

UBA6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13211-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

MOP4, MOP 4, Monocyte protein 4, EC:6.2.1.45, E1-L2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human brain tissue
• Positive IHC detected in: mouse testis tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

13211-1-AP targets UBA6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4000

  Product name: Recombinant human UBA6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 87-389 aa of BC031637

  Sequence: AVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY

• Full Name: ubiquitin-like modifier activating enzyme 6
• Calculated Molecular Weight: 1052 aa, 118 kDa
• Observed Molecular Weight: 118 kDa
• GenBank Accession Number: BC031637
• Gene Symbol: UBA6
• Gene ID (NCBI): 55236
• RRID: AB_2211747
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0AVT1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBA6(Ubiquitin-like modifier-activating enzyme 6) is also named as MOP4, UBE1L2 and belongs to the ubiquitin-activating E1 family. It probably acts as a single molecule like UBE1 and not as a heterodimeric E1 complex, as formed by AOS1/Uba2 and APP-BP1/Uba3. UBA6 is even more restricted in distribution because it is only found in vertebrates but not in lower organisms so that it might have a specialized role in tissues of higher organisms, and in particular, in the testis, where it is expressed by far most abundantly.(PMID:17580310). It has 4 isoforms produced by alternative splicing. This antibody recognizes the full-length(118 kda) and the truncated isoform CRA_b (60-70 kDa) of UBA6 (NCBI).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IHC,IP	Nat Commun; Inhibition of UBA6 by inosine augments tumour immunogenicity and responses; Authors - Lei Zhang
human	WB	Cell Rep; Lactylation orchestrates ubiquitin-independent degradation of cGAS and promotes tumor growth; Authors - Keqiang Rao ; KD Validated