UBAP1L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBAP1L Polyclonal antibody (31189-1-AP)

• 

  WB analysis using 31189-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 31189-1-AP (UBAP1L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

UBAP1L Polyclonal Antibody for WB, ELISA

Cat No. 31189-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

LOC390595, UBAP-1L, Ubiquitin-associated protein 1-like

---

Tested Applications

• Positive WB detected in: Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31189-1-AP targets UBAP1L in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34816

  Product name: Recombinant human UBAP1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-381 aa of NM_001163692

  Sequence: TTIRDPEAGHQERPEEEGEDEAEASSGSEEEPAPSSLQPGSPASPGPGRRLCSLDVLRGVRLELAGARRRLSEGKLVSRPRALLHGLRGHRALSLCPSPAQSPRSASPPGPAPQHPAAPASPPRPSTAGAIPPLRSHKPTVASLSPYTCLPPLGGAPQPLNPHKSHPDTAADLLSALSQEEQDLIGPVVALGYPLRRAIIALQKTGRQSLSQFLSYLSACDRLLRQGYEEGLVDEAMEMFQFSESQAGEFLRLWEQFSDMGFQQDRIKEVLLVHGNRREQALEELVACAQ

• Full Name: similar to ubiquitin-associated protein 1 (predicted)
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: NM_001163692
• Gene Symbol: LOC390595
• Gene ID (NCBI): 390595
• RRID: AB_3742404
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: F5GYI3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBAP1L, is a fairly unknown protein. It is predicted to enable ubiquitin binding activity and is believed to be involved in the ubiquitin-dependent protein catabolic process through the multivesicular body sorting pathway. It is also predicted to be part of endosomal sorting complexes required for transport. UBAP1L contains a SOUBA domain, which begins at amino acid residue 269 and extends to the C terminus of the protein. This domain is similar to the one found in UBAP1, where it is known to interact with ubiquitin (PMID: 38293907).