UBC9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87319-1-RR (same clone as 87319-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87319-1-RR (UBC9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87319-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87319-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87319-1-RR against Human UBC9 were performed. The affinity constant is 0.561 nM.

UBC9 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87319-1-PBS

Clone No.252569G10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

UBE2I, C358B7.1, E2,UBE2I, EC:2.3.2.-, P18

---

Product Information

87319-1-PBS targets UBC9 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0111

  Product name: Recombinant human UBC9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC004437

  Sequence: VPGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYWLVAALAPLVAAPPRPSQGRLAGREWSTQAHPRDSQGPRLC

• Full Name: ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC004437
• Gene Symbol: UBC9
• Gene ID (NCBI): 7329
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P63279
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UBC9 is also named as UBE2I, UBCE9 and belongs to the ubiquitin-conjugating enzyme family. It is a homologue of the E2 ubiquitin conjugating enzyme and participates in the covalent linking of SUMO-1 molecule to the target protein. This protein is present at a high level in spleen and lung. Moderate level of UBC9 is detected in kidney and liver.